D7net
Home
Console
Upload
information
Create File
Create Folder
About
Tools
:
/
var
/
migration_dir
/
Filename :
cpmove-inter210.tar_db.log.1.1.1.1
back
Copy
Attempting restoration of the account backup “/var/migration_dir/cpmove-inter210.tar” (user: inter210) … cPanel restorepkg version: 2.3 Archive user: inter210 Restricted: no Allow Reseller Privileges: no The system will attempt to restore the archive file “/var/migration_dir/cpmove-inter210.tar”. ---------------------------------------------------------------------- You have successfully enqueued this account’s restoration. This restoration’s ID is “just2054justhoresto20191115061254DDD”. You can see the progress of this restoration below. If you need to show this again, run the following command: /usr/local/cpanel/bin/view_transfer just2054justhoresto20191115061254DDD ---------------------------------------------------------------------- The transfer with the session id, “just2054justhoresto20191115061254DDD” is running with PID “821295”. [821295][MASTER ]: Start Session [821295][MASTER ]: Version: 2.3 [821295][MASTER ]: Queue “RESTORE” items: 1 [821295][MASTER ]: Remote Host: [821296][RESTORE:1 ]: Starting “Account”: inter210 [821296][RESTORE:1 ][A:inter210 ]: Progress: 0% (2019-11-14 23:12:55 -0700) [821296][RESTORE:1 ][A:inter210 ]: Starting “RESTORE” for “Account” “inter210”. [821296][RESTORE:1 ][A:inter210 ]: Progress: 10% (2019-11-14 23:12:55 -0700) [821296][RESTORE:1 ][A:inter210 ]: Restore File: /var/migration_dir/cpmove-inter210.tar [821296][RESTORE:1 ][A:inter210 ]: Restore Reseller Privs: no [821296][RESTORE:1 ][A:inter210 ]: Restricted mode: no [821296][RESTORE:1 ][A:inter210 ]: Express mode: no [821296][RESTORE:1 ][A:inter210 ]: Target “/var/migration_dir” on host “just2054.justhost.com” has 456.73 GB free and requires at least 99.54 MB free, which includes space for temporary files. [821296][RESTORE:1 ][A:inter210 ]: The “Reseller” restore module has the following areas disabled by request: “all” [821296][RESTORE:1 ][A:inter210 ]: The “Account” restore module has the following areas disabled by request: “all” [821296][RESTORE:1 ][A:inter210 ]: ArchiveManager [821296][RESTORE:1 ][A:inter210 ]: Preparing archive for restoration … [821296][RESTORE:1 ][A:inter210 ]: Calculating disk space needed … [821296][RESTORE:1 ][A:inter210 ]: Done. [821296][RESTORE:1 ][A:inter210 ]: Target “/var/migration_dir/cpanelpkgrestore.TMP.work.7b3275da/unsafe_to_read_archive” on host “just2054.justhost.com” has 456.73 GB free and requires at least 99.54 MB free, which includes space for temporary files. [821296][RESTORE:1 ][A:inter210 ]: This archive’s payload appears to be in the archive’s “cpmove-inter210” directory. [821296][RESTORE:1 ][A:inter210 ]: ArchiveManager [821296][RESTORE:1 ][A:inter210 ]: The system successfully prepared the archive for restoration. [821296][RESTORE:1 ][A:inter210 ]: PreRestoreActions [821296][RESTORE:1 ][A:inter210 ]: Temporarily lifting quota for existing user to ensure that all data is transferred. [821296][RESTORE:1 ][A:inter210 ]: Running prerestore script [821296][RESTORE:1 ][A:inter210 ]: PreRestoreActions [821296][RESTORE:1 ][A:inter210 ]: Can't locate object method "die" via package "Whostmgr::Transfers::Utils" at /usr/local/cpanel/Whostmgr/Transfers/Systems/PreRestoreActions.pm line 84. [821296][RESTORE:1 ][A:inter210 ]: Progress: 15% (2019-11-14 23:12:55 -0700) [821296][RESTORE:1 ][A:inter210 ]: IPAddress [821296][RESTORE:1 ][A:inter210 ]: IPAddress [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 16% (2019-11-14 23:12:55 -0700) [821296][RESTORE:1 ][A:inter210 ]: CpUser [821296][RESTORE:1 ][A:inter210 ]: Restoring cPanel user file. [821296][RESTORE:1 ][A:inter210 ]: Updating Caches … [821296][RESTORE:1 ][A:inter210 ]: CpUser [821296][RESTORE:1 ][A:inter210 ]: CpUser data restored [821296][RESTORE:1 ][A:inter210 ]: Progress: 17% (2019-11-14 23:12:56 -0700) [821296][RESTORE:1 ][A:inter210 ]: Package [821296][RESTORE:1 ][A:inter210 ]: Package [821296][RESTORE:1 ][A:inter210 ]: The package exists on the system. [821296][RESTORE:1 ][A:inter210 ]: Progress: 18% (2019-11-14 23:12:56 -0700) [821296][RESTORE:1 ][A:inter210 ]: FeatureList [821296][RESTORE:1 ][A:inter210 ]: FeatureList [821296][RESTORE:1 ][A:inter210 ]: Feature list exists. [821296][RESTORE:1 ][A:inter210 ]: Progress: 19% (2019-11-14 23:12:56 -0700) [821296][RESTORE:1 ][A:inter210 ]: Homedir [821296][RESTORE:1 ][A:inter210 ]: Restoring Homedir… [821296][RESTORE:1 ][A:inter210 ]: This account archive contains no home directory files to restore. [821296][RESTORE:1 ][A:inter210 ]: Homedir [821296][RESTORE:1 ][A:inter210 ]: Homedir restored [821296][RESTORE:1 ][A:inter210 ]: Progress: 28% (2019-11-14 23:12:56 -0700) [821296][RESTORE:1 ][A:inter210 ]: Domains [821296][RESTORE:1 ][A:inter210 ]: Retrieving and sanitizing main userdata … [821296][RESTORE:1 ][A:inter210 ]: Parsing domain databases … [821296][RESTORE:1 ][A:inter210 ]: …Subdomains… [821296][RESTORE:1 ][A:inter210 ]: …ParkedDomains… [821296][RESTORE:1 ][A:inter210 ]: Failed to open(/var/migration_dir/cpanelpkgrestore.TMP.work.7b3275da/safe_to_read_archive/contents/pds): No such file or directory [821296][RESTORE:1 ][A:inter210 ]: …AddonDomains… [821296][RESTORE:1 ][A:inter210 ]: Failed to open(/var/migration_dir/cpanelpkgrestore.TMP.work.7b3275da/safe_to_read_archive/contents/addons): No such file or directory [821296][RESTORE:1 ][A:inter210 ]: Restoring Domains … [821296][RESTORE:1 ][A:inter210 ]: Updating internal databases… [821296][RESTORE:1 ][A:inter210 ]: Domains [821296][RESTORE:1 ][A:inter210 ]: Domains restored [821296][RESTORE:1 ][A:inter210 ]: Progress: 30% (2019-11-14 23:12:56 -0700) [821296][RESTORE:1 ][A:inter210 ]: OldHomedirs [821296][RESTORE:1 ][A:inter210 ]: Linking old home directories [821296][RESTORE:1 ][A:inter210 ]: The system will restore the old home directory link “/home3/inter210” … [821296][RESTORE:1 ][A:inter210 ]: Done. [821296][RESTORE:1 ][A:inter210 ]: OldHomedirs [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Roundcube [821296][RESTORE:1 ][A:inter210 ]: Roundcube [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 32% (2019-11-14 23:12:56 -0700) [821296][RESTORE:1 ][A:inter210 ]: Mysql [821296][RESTORE:1 ][A:inter210 ]: Preparing MySQL restore … [821296][RESTORE:1 ][A:inter210 ]: Databases owned by “inter210” will be overwritten on conflict. [821296][RESTORE:1 ][A:inter210 ]: Restoring MySQL databases [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrd2” as “inter210_wrd2” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrd2”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrd2” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrd2” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrd2” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrd2” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrd2” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrd2” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrd2” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd2” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd2” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd2” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd2” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrd2”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wo1412” as “inter210_wo1412” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wo1412”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wo1412” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wo1412” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wo1412” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wo1412” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wo1412” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wo1412” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wo1412” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo1412” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo1412” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo1412” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo1412” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wo1412”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wo6718” as “inter210_wo6718” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wo6718”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wo6718” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wo6718” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wo6718” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wo6718” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wo6718” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wo6718” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wo6718” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo6718” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo6718” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo6718” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo6718” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wo6718”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrdp4” as “inter210_wrdp4” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrdp4”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrdp4” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrdp4” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrdp4” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrdp4” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrdp4” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrdp4” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrdp4” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp4” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp4” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp4” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp4” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrdp4”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrdp3” as “inter210_wrdp3” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrdp3”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrdp3” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrdp3” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrdp3” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrdp3” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrdp3” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrdp3” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrdp3” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp3” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp3” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp3” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp3” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrdp3”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname499” as “inter210_ss_dbname499” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname499”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname499” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname499” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname499” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname499” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname499” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname499” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname499” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname499” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname499” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname499” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname499” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname499”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname145” as “inter210_ss_dbname145” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname145”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname145” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname145” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname145” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname145” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname145” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname145” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname145” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname145” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname145” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname145” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname145” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname145”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrdp2” as “inter210_wrdp2” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrdp2”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrdp2” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrdp2” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrdp2” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrdp2” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrdp2” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrdp2” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrdp2” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp2” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp2” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp2” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp2” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrdp2”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor11” as “inter210_wor11” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor11”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor11” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor11” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor11” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor11” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor11” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor11” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor11” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor11” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor11” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor11” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor11” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor11”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname243” as “inter210_ss_dbname243” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname243”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname243” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname243” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname243” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname243” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname243” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname243” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname243” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname243” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname243” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname243” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname243” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname243”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnameebb” as “inter210_ss_dbnameebb” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnameebb”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnameebb” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnameebb” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnameebb” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnameebb” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnameebb” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnameebb” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnameebb” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnameebb” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnameebb” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnameebb” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnameebb” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnameebb”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor15” as “inter210_wor15” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor15”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor15” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor15” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor15” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor15” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor15” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor15” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor15” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor15” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor15” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor15” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor15” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor15”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor1880” as “inter210_wor1880” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor1880”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor1880” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor1880” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor1880” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor1880” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor1880” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor1880” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor1880” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor1880” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor1880” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor1880” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor1880” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor1880”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor2126” as “inter210_wor2126” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor2126”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor2126” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor2126” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor2126” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor2126” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor2126” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor2126” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor2126” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2126” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2126” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2126” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2126” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor2126”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor0828” as “inter210_wor0828” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor0828”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor0828” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor0828” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor0828” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor0828” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor0828” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor0828” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor0828” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor0828” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor0828” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor0828” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor0828” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor0828”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wp838” as “inter210_wp838” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wp838”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wp838” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wp838” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wp838” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wp838” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wp838” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wp838” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wp838” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wp838” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wp838” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wp838” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wp838” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wp838”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamebf2” as “inter210_ss_dbnamebf2” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamebf2”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamebf2” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamebf2” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamebf2” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamebf2” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamebf2” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamebf2” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamebf2” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamebf2” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamebf2” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamebf2” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamebf2” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamebf2”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wo0958” as “inter210_wo0958” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wo0958”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wo0958” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wo0958” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wo0958” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wo0958” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wo0958” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wo0958” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wo0958” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo0958” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo0958” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo0958” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo0958” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wo0958”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor14” as “inter210_wor14” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor14”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor14” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor14” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor14” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor14” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor14” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor14” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor14” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor14” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor14” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor14” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor14” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor14”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname406” as “inter210_ss_dbname406” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname406”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname406” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname406” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname406” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname406” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname406” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname406” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname406” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname406” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname406” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname406” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname406” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname406”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor9” as “inter210_wor9” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor9”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor9” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor9” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor9” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor9” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor9” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor9” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor9” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor9” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor9” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor9” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor9” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor9”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wordpress003” as “inter210_wordpress003” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wordpress003”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wordpress003” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wordpress003” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wordpress003” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wordpress003” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wordpress003” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wordpress003” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wordpress003” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpress003” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpress003” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpress003” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpress003” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wordpress003”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname8e6” as “inter210_ss_dbname8e6” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname8e6”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname8e6” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname8e6” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname8e6” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname8e6” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname8e6” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname8e6” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname8e6” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname8e6” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname8e6” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname8e6” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname8e6” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname8e6”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname69e” as “inter210_ss_dbname69e” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname69e”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname69e” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname69e” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname69e” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname69e” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname69e” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname69e” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname69e” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname69e” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname69e” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname69e” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname69e” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname69e”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wo1955” as “inter210_wo1955” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wo1955”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wo1955” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wo1955” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wo1955” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wo1955” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wo1955” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wo1955” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wo1955” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo1955” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo1955” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo1955” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo1955” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wo1955”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrdp1” as “inter210_wrdp1” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrdp1”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrdp1” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrdp1” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrdp1” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrdp1” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrdp1” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrdp1” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrdp1” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp1” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp1” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp1” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp1” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrdp1”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor12” as “inter210_wor12” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor12”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor12” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor12” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor12” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor12” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor12” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor12” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor12” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor12” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor12” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor12” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor12” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor12”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor8” as “inter210_wor8” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor8”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor8” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor8” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor8” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor8” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor8” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor8” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor8” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor8” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor8” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor8” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor8” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor8”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor2991” as “inter210_wor2991” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor2991”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor2991” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor2991” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor2991” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor2991” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor2991” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor2991” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor2991” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2991” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2991” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2991” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2991” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor2991”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wordpressc7b” as “inter210_wordpressc7b” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wordpressc7b”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wordpressc7b” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wordpressc7b” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wordpressc7b” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wordpressc7b” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wordpressc7b” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wordpressc7b” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wordpressc7b” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpressc7b” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpressc7b” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpressc7b” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpressc7b” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wordpressc7b”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor13” as “inter210_wor13” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor13”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor13” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor13” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor13” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor13” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor13” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor13” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor13” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor13” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor13” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor13” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor13” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor13”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname925” as “inter210_ss_dbname925” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname925”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname925” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname925” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname925” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname925” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname925” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname925” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname925” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname925” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname925” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname925” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname925” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname925”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wo3087” as “inter210_wo3087” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wo3087”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wo3087” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wo3087” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wo3087” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wo3087” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wo3087” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wo3087” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wo3087” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo3087” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo3087” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo3087” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo3087” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wo3087”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrdp5” as “inter210_wrdp5” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrdp5”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrdp5” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrdp5” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrdp5” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrdp5” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrdp5” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrdp5” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrdp5” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp5” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp5” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp5” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp5” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrdp5”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamefee” as “inter210_ss_dbnamefee” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamefee”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamefee” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamefee” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamefee” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamefee” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamefee” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamefee” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamefee” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamefee” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamefee” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamefee” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamefee” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamefee”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wordpressba5” as “inter210_wordpressba5” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wordpressba5”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wordpressba5” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wordpressba5” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wordpressba5” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wordpressba5” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wordpressba5” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wordpressba5” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wordpressba5” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpressba5” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpressba5” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpressba5” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpressba5” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wordpressba5”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamedc7” as “inter210_ss_dbnamedc7” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamedc7”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamedc7” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamedc7” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamedc7” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamedc7” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamedc7” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamedc7” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamedc7” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamedc7” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamedc7” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamedc7” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamedc7” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamedc7”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor2” as “inter210_wor2” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor2”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor2” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor2” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor2” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor2” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor2” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor2” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor2” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor2”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname799” as “inter210_ss_dbname799” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname799”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname799” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname799” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname799” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname799” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname799” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname799” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname799” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname799” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname799” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname799” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname799” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname799”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrdp8” as “inter210_wrdp8” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrdp8”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrdp8” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrdp8” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrdp8” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrdp8” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrdp8” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrdp8” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrdp8” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp8” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp8” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp8” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp8” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrdp8”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname85e” as “inter210_ss_dbname85e” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname85e”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname85e” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname85e” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname85e” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname85e” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname85e” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname85e” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname85e” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname85e” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname85e” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname85e” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname85e” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname85e”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamecb6” as “inter210_ss_dbnamecb6” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamecb6”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamecb6” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamecb6” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamecb6” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamecb6” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamecb6” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamecb6” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamecb6” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecb6” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecb6” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecb6” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecb6” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamecb6”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor2385” as “inter210_wor2385” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor2385”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor2385” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor2385” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor2385” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor2385” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor2385” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor2385” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor2385” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2385” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2385” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2385” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2385” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor2385”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamebb5” as “inter210_ss_dbnamebb5” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamebb5”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamebb5” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamebb5” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamebb5” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamebb5” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamebb5” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamebb5” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamebb5” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamebb5” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamebb5” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamebb5” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamebb5” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamebb5”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamee63” as “inter210_ss_dbnamee63” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamee63”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamee63” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamee63” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamee63” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamee63” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamee63” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamee63” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamee63” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamee63” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamee63” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamee63” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamee63” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamee63”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor7” as “inter210_wor7” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor7”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor7” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor7” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor7” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor7” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor7” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor7” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor7” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor7” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor7” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor7” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor7” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor7”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrdp7” as “inter210_wrdp7” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrdp7”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrdp7” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrdp7” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrdp7” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrdp7” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrdp7” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrdp7” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrdp7” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp7” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp7” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp7” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp7” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrdp7”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname707” as “inter210_ss_dbname707” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname707”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname707” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname707” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname707” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname707” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname707” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname707” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname707” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname707” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname707” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname707” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname707” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname707”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrd1” as “inter210_wrd1” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrd1”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrd1” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrd1” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrd1” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrd1” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrd1” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrd1” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrd1” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd1” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd1” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd1” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd1” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrd1”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname3fe” as “inter210_ss_dbname3fe” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname3fe”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname3fe” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname3fe” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname3fe” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname3fe” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname3fe” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname3fe” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname3fe” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname3fe” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname3fe” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname3fe” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname3fe” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname3fe”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamec5f” as “inter210_ss_dbnamec5f” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamec5f”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamec5f” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamec5f” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamec5f” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamec5f” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamec5f” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamec5f” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamec5f” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamec5f” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamec5f” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamec5f” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamec5f” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamec5f”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname111” as “inter210_ss_dbname111” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname111”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname111” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname111” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname111” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname111” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname111” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname111” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname111” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname111” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname111” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname111” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname111” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname111”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname1ed” as “inter210_ss_dbname1ed” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname1ed”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname1ed” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname1ed” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname1ed” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname1ed” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname1ed” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname1ed” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname1ed” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname1ed” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname1ed” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname1ed” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname1ed” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname1ed”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrdp9” as “inter210_wrdp9” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrdp9”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrdp9” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrdp9” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrdp9” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrdp9” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrdp9” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrdp9” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrdp9” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp9” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp9” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp9” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp9” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrdp9”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor16” as “inter210_wor16” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor16”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor16” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor16” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor16” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor16” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor16” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor16” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor16” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor16” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor16” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor16” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor16” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor16”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamecae” as “inter210_ss_dbnamecae” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamecae”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamecae” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamecae” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamecae” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamecae” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamecae” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamecae” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamecae” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecae” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecae” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecae” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecae” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamecae”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor3” as “inter210_wor3” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor3”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor3” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor3” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor3” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor3” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor3” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor3” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor3” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor3” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor3” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor3” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor3” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor3”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamecc6” as “inter210_ss_dbnamecc6” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamecc6”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamecc6” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamecc6” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamecc6” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamecc6” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamecc6” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamecc6” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamecc6” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecc6” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecc6” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecc6” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamecc6” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamecc6”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrd3” as “inter210_wrd3” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrd3”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrd3” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrd3” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrd3” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrd3” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrd3” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrd3” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrd3” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd3” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd3” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd3” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrd3” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrd3”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor10” as “inter210_wor10” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor10”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor10” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor10” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor10” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor10” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor10” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor10” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor10” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor10” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor10” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor10” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor10” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor10”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname2f8” as “inter210_ss_dbname2f8” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname2f8”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname2f8” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname2f8” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname2f8” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname2f8” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname2f8” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname2f8” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname2f8” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname2f8” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname2f8” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname2f8” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname2f8” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname2f8”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor18” as “inter210_wor18” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor18”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor18” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor18” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor18” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor18” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor18” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor18” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor18” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor18” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor18” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor18” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor18” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor18”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wordpress6dd” as “inter210_wordpress6dd” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wordpress6dd”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wordpress6dd” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wordpress6dd” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wordpress6dd” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wordpress6dd” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wordpress6dd” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wordpress6dd” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wordpress6dd” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpress6dd” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpress6dd” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpress6dd” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wordpress6dd” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wordpress6dd”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor4” as “inter210_wor4” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor4”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor4” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor4” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor4” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor4” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor4” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor4” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor4” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor4” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor4” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor4” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor4” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor4”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wo0988” as “inter210_wo0988” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wo0988”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wo0988” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wo0988” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wo0988” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wo0988” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wo0988” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wo0988” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wo0988” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo0988” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo0988” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo0988” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wo0988” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wo0988”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamed46” as “inter210_ss_dbnamed46” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamed46”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamed46” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamed46” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamed46” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamed46” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamed46” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamed46” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamed46” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamed46” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamed46” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamed46” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamed46” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamed46”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname413” as “inter210_ss_dbname413” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname413”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname413” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname413” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname413” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname413” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname413” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname413” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname413” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname413” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname413” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname413” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname413” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname413”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor1” as “inter210_wor1” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor1”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor1” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor1” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor1” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor1” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor1” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor1” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor1” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor1” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor1” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor1” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor1” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor1”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor5” as “inter210_wor5” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor5”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor5” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor5” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor5” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor5” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor5” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor5” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor5” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor5” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor5” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor5” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor5” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor5”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname09e” as “inter210_ss_dbname09e” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname09e”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname09e” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname09e” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname09e” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname09e” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname09e” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname09e” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname09e” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname09e” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname09e” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname09e” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname09e” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname09e”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnameb0a” as “inter210_ss_dbnameb0a” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnameb0a”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnameb0a” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnameb0a” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnameb0a” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnameb0a” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnameb0a” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnameb0a” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnameb0a” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnameb0a” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnameb0a” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnameb0a” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnameb0a” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnameb0a”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor17” as “inter210_wor17” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor17”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor17” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor17” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor17” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor17” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor17” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor17” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor17” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor17” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor17” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor17” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor17” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor17”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname61c” as “inter210_ss_dbname61c” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname61c”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname61c” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname61c” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname61c” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname61c” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname61c” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname61c” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname61c” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname61c” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname61c” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname61c” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname61c” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname61c”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbnamedd4” as “inter210_ss_dbnamedd4” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbnamedd4”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbnamedd4” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbnamedd4” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbnamedd4” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbnamedd4” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbnamedd4” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbnamedd4” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbnamedd4” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamedd4” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamedd4” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamedd4” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbnamedd4” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbnamedd4”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_aaron” as “inter210_aaron” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_aaron”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_aaron” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_aaron” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_aaron” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_aaron” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_aaron” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_aaron” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_aaron” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_aaron” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_aaron” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_aaron” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_aaron” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_aaron”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor19” as “inter210_wor19” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor19”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor19” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor19” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor19” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor19” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor19” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor19” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor19” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor19” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor19” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor19” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor19” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor19”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wrdp6” as “inter210_wrdp6” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wrdp6”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wrdp6” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wrdp6” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wrdp6” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wrdp6” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wrdp6” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wrdp6” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wrdp6” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp6” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp6” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp6” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wrdp6” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wrdp6”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor6” as “inter210_wor6” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor6”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor6” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor6” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor6” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor6” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor6” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor6” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor6” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor6” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor6” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor6” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor6” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor6”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_ss_dbname0e1” as “inter210_ss_dbname0e1” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_ss_dbname0e1”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_ss_dbname0e1” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_ss_dbname0e1” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_ss_dbname0e1” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_ss_dbname0e1” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_ss_dbname0e1” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_ss_dbname0e1” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_ss_dbname0e1” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname0e1” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname0e1” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname0e1” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_ss_dbname0e1” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_ss_dbname0e1”. [821296][RESTORE:1 ][A:inter210 ]: Restoring the database “inter210_wor2869” as “inter210_wor2869” … [821296][RESTORE:1 ][A:inter210 ]: The system has created a new database named “inter210_wor2869”. [821296][RESTORE:1 ][A:inter210 ]: Granting “inter210” access to “inter210_wor2869” with temporary password … [821296][RESTORE:1 ][A:inter210 ]: Spawning restoration subprocess for “inter210_wor2869” … [821296][RESTORE:1 ][A:inter210 ]: Connecting to MySQL server as “inter210” in order to restore “inter210_wor2869” … [821296][RESTORE:1 ][A:inter210 ]: Releasing objects in preparation for database restore for “inter210_wor2869” … [821296][RESTORE:1 ][A:inter210 ]: Cleaning up in preparation for database restore for “inter210_wor2869” … [821296][RESTORE:1 ][A:inter210 ]: Disabling InnoDB strict mode for database restore for “inter210_wor2869” … [821296][RESTORE:1 ][A:inter210 ]: Restoring database data for “inter210_wor2869” … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2869” is running … [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2869” has opened the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2869” has closed the SQL archive. [821296][RESTORE:1 ][A:inter210 ]: The database restoration subprocess for “inter210_wor2869” has ended. [821296][RESTORE:1 ][A:inter210 ]: The system has restored the contents of the database “inter210_wor2869”. [821296][RESTORE:1 ][A:inter210 ]: Restoring MySQL database mappings [821296][RESTORE:1 ][A:inter210 ]: Restoring MySQL privileges [821296][RESTORE:1 ][A:inter210 ]: Database users owned by “inter210” will be overwritten on conflict. [821296][RESTORE:1 ][A:inter210 ]: The system will restore the database user “inter210” as “inter2102” because another cPanel user owns “inter210”. [821296][RESTORE:1 ][A:inter210 ]: Restoring MySQL grants [821296][RESTORE:1 ][A:inter210 ]: Restoring MySQL access hosts [821296][RESTORE:1 ][A:inter210 ]: Storing MySQL Grants [821296][RESTORE:1 ][A:inter210 ]: Mysql [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 35% (2019-11-14 23:13:28 -0700) [821296][RESTORE:1 ][A:inter210 ]: NobodyFiles [821296][RESTORE:1 ][A:inter210 ]: NobodyFiles [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 36% (2019-11-14 23:13:28 -0700) [821296][RESTORE:1 ][A:inter210 ]: DKIM [821296][RESTORE:1 ][A:inter210 ]: DKIM [821296][RESTORE:1 ][A:inter210 ]: DKIM restored [821296][RESTORE:1 ][A:inter210 ]: Progress: 38% (2019-11-14 23:13:28 -0700) [821296][RESTORE:1 ][A:inter210 ]: Horde [821296][RESTORE:1 ][A:inter210 ]: Restoring Horde (if any) [821296][RESTORE:1 ][A:inter210 ]: Updating the horde configuration. [821296][RESTORE:1 ][A:inter210 ]: : Running database checks for 1 account(s) … [821296][RESTORE:1 ][A:inter210 ]: Starting update of 1 user in parallel … [821296][RESTORE:1 ][A:inter210 ]: ------------------------------------------------------------------------ [821296][RESTORE:1 ][A:inter210 ]: Summary: [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Ran database checks on 1 account(s). [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: There were 0 accounts with failures during this process (see above): [821296][RESTORE:1 ][A:inter210 ]: n/a [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: There were 1 accounts successfully processed: [821296][RESTORE:1 ][A:inter210 ]: inter210 [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: There were 0 accounts that did not need any work done: [821296][RESTORE:1 ][A:inter210 ]: n/a [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: [2019-11-14 23:13:28 -0700] info [update_horde_config] Quota file /home1/inter210/etc/theglobaldigitalmarketingagency.com/quota does not exist; skipping [821296][RESTORE:1 ][A:inter210 ]: [2019-11-14 23:13:28 -0700] info [update_horde_config] Quota file /home1/inter210/etc/dgdigitalmarketing.com.au/quota does not exist; skipping [821296][RESTORE:1 ][A:inter210 ]: Fixing hostnames: just39.justhost.com => just2054.justhost.com. [821296][RESTORE:1 ][A:inter210 ]: Horde [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Mail [821296][RESTORE:1 ][A:inter210 ]: Restoring Mail files [821296][RESTORE:1 ][A:inter210 ]: Resetting Quotas to sane values [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Mail [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 40% (2019-11-14 23:13:29 -0700) [821296][RESTORE:1 ][A:inter210 ]: MailFix [821296][RESTORE:1 ][A:inter210 ]: Fixing mail permissions [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Converting to maildir if needed [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: MailFix [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 41% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: Integration [821296][RESTORE:1 ][A:inter210 ]: Integration [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 42% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: AutoSSL [821296][RESTORE:1 ][A:inter210 ]: AutoSSL [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 43% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: Counter [821296][RESTORE:1 ][A:inter210 ]: Restoring Counter Data [821296][RESTORE:1 ][A:inter210 ]: Counter [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 44% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: PublicContact [821296][RESTORE:1 ][A:inter210 ]: PublicContact [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 46% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: Mailman [821296][RESTORE:1 ][A:inter210 ]: Restoring Mailman lists [821296][RESTORE:1 ][A:inter210 ]: Mailman [821296][RESTORE:1 ][A:inter210 ]: Mailman Restored [821296][RESTORE:1 ][A:inter210 ]: Unsuspend [821296][RESTORE:1 ][A:inter210 ]: Unsuspending .htaccess files for domains passiveincomeedge.com, aaronwitnish.com.au, aaronwitnish.passiveincomeedge.com, nicoleswanell.passiveincomeedge.com, keepcurious.passiveincomeedge.com, evobuilt.com.au, globaleconomy.passiveincomeedge.com, timewithnicole.passiveincomeedge.com, theglobaldigitalmarketingagency.com, clickbank.passiveincomeedge.com, 5stardigitalmarketingagency-com-au.passiveincomeedge.com, williamsplumbinganddrainage-com-au.passiveincomeedge.com, freepreneurs.com.au, zanetully.com, stocks.passiveincomeedge.com, williamsplumbinganddrainage.com.au, freebrokerconsultation.com, budgeting.passiveincomeedge.com, blogging.passiveincomeedge.com, freepreneurstraining.passiveincomeedge.com, tasteactivelife.passiveincomeedge.com, quotesfortradies.com.au, streetsmartbusiness.net, timewithjamie.passiveincomeedge.com, jkwitnishcarpentry-com-au.passiveincomeedge.com, finance.passiveincomeedge.com, quotesfortradies-com-au.passiveincomeedge.com, dpkaircon.com.au, tattoodesignsideas.passiveincomeedge.com, jkwitnishcarpentry.com.au, stockmarket.passiveincomeedge.com, ubctradeservicesquote-com-au.passiveincomeedge.com, theglobaldigitalmarketingagency.passiveincomeedge.com, joinpbazz.passiveincomeedge.com, josevila.passiveincomeedge.com, timewithzane.passiveincomeedge.com, worklifeandbalance.passiveincomeedge.com, seansoolevideos.passiveincomeedge.com, bondinvesting.passiveincomeedge.com, homeequity.passiveincomeedge.com, ubctradeservicesquote.com.au, janicekuz.com, cellphone.passiveincomeedge.com, membershipsites.passiveincomeedge.com, jamiesayedonline.passiveincomeedge.com, blog.passiveincomeedge.com, dgdigitalmarketing.com.au, timewithjanice.passiveincomeedge.com, listbuilding.passiveincomeedge.com, timewithaaron.com, videomarketing.passiveincomeedge.com, forex.passiveincomeedge.com, freepreneurstraining.com, members.passiveincomeedge.com, streetsmartbusiness-net.passiveincomeedge.com, timewithaaron.passiveincomeedge.com, attorney.passiveincomeedge.com, dpkaircon-com-au.passiveincomeedge.com, thedigitalmarketingagency-com-au.passiveincomeedge.com, thedigitalmarketingagency.com.au, 2014applications.passiveincomeedge.com, freepreneurs-com-au.passiveincomeedge.com, sixfigurecoaching-com-au.passiveincomeedge.com, electricianquote-online.passiveincomeedge.com, snowboardelite.passiveincomeedge.com, videostoprofit-com-au.passiveincomeedge.com, electricianquote.online, 5stardigitalmarketingagency.com.au, sixfigurecoaching.com.au, freebrokerconsultationjusthost.passiveincomeedge.com, 10kin30days-com-au.passiveincomeedge.com, metals.passiveincomeedge.com, paulabailey.com.au, aaronwitnish.com, offlinemarketing.passiveincomeedge.com, tasteactivelife.com, onlinebusiness.passiveincomeedge.com, zahrapeermohamed.passiveincomeedge.com, worklifebalancecourse.passiveincomeedge.com, zanetully.passiveincomeedge.com, nathanjensencoaching.com, timewithjose.passiveincomeedge.com, dgdigitalmarketing-com-au.passiveincomeedge.com, freebuildingquote.passiveincomeedge.com, seansoolevideos.com, paidsurveys.passiveincomeedge.com, freebrokerconsultation.com.au, nathanjensencoaching.passiveincomeedge.com, aaronwitnish-com-au.passiveincomeedge.com, doneforyoubusinesses.com.au, freeelectricianquote.com, paulabailey-com-au.passiveincomeedge.com, cpmoney-com-au.passiveincomeedge.com, pbazz.passiveincomeedge.com, aaroninvesting.passiveincomeedge.com, sharerenting.passiveincomeedge.com, taniapoletti.passiveincomeedge.com, freeelectricianquote.passiveincomeedge.com, thefastestpathtocash-net.passiveincomeedge.com, janicekuz.passiveincomeedge.com, flowdigitalmarketing.com.au, louvresandprivacyscreens.com, successsoldier.passiveincomeedge.com, josevila.com, owningyourdreams.passiveincomeedge.com, doneforyoubusinesses-com-au.passiveincomeedge.com, ebay.passiveincomeedge.com, freebuildingquote.com, flowdigitalmarketing-com-au.passiveincomeedge.com, the-transformers-com-au.passiveincomeedge.com, evobuilt-com-au.passiveincomeedge.com, nichewebsites.passiveincomeedge.com, shauneveringtonfitness.passiveincomeedge.com, shauneveringtonfitness.com, louvresandprivacyscreens.passiveincomeedge.com, and freebrokerconsultation-com-au.passiveincomeedge.com. [821296][RESTORE:1 ][A:inter210 ]: Unsuspend [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 47% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: BackupConfig [821296][RESTORE:1 ][A:inter210 ]: Restoring backup config … [821296][RESTORE:1 ][A:inter210 ]: Updated backup config for “inter210”. [821296][RESTORE:1 ][A:inter210 ]: Restoring legacy backup config … [821296][RESTORE:1 ][A:inter210 ]: Updated legacy backup config for “inter210”. [821296][RESTORE:1 ][A:inter210 ]: BackupConfig [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 49% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: CustomLocale [821296][RESTORE:1 ][A:inter210 ]: CustomLocale [821296][RESTORE:1 ][A:inter210 ]: OK [821296][RESTORE:1 ][A:inter210 ]: Progress: 50% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: PublicHtmlSymlinks [821296][RESTORE:1 ][A:inter210 ]: PublicHtmlSymlinks [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 51% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: Shell [821296][RESTORE:1 ][A:inter210 ]: Shell [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 52% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: VhostIncludes [821296][RESTORE:1 ][A:inter210 ]: Restoring custom virtualhost templates… [821296][RESTORE:1 ][A:inter210 ]: VhostIncludes [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 53% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: userdata [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata… [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “williamsplumbinganddrainage-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “williamsplumbinganddrainage-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “5stardigitalmarketingagency-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “5stardigitalmarketingagency-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “thedigitalmarketingagency-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “thedigitalmarketingagency-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “theglobaldigitalmarketingagency.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “theglobaldigitalmarketingagency.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “freebrokerconsultationjusthost.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “freebrokerconsultationjusthost.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “freebrokerconsultation-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “freebrokerconsultation-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “ubctradeservicesquote-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “ubctradeservicesquote-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “flowdigitalmarketing-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “flowdigitalmarketing-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “doneforyoubusinesses-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “doneforyoubusinesses-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “jkwitnishcarpentry-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “jkwitnishcarpentry-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “dgdigitalmarketing-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “dgdigitalmarketing-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “thefastestpathtocash-net.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “thefastestpathtocash-net.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “sixfigurecoaching-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “sixfigurecoaching-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “louvresandprivacyscreens.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “louvresandprivacyscreens.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “the-transformers-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “the-transformers-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “streetsmartbusiness-net.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “streetsmartbusiness-net.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “quotesfortradies-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “quotesfortradies-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “electricianquote-online.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “electricianquote-online.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “shauneveringtonfitness.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “shauneveringtonfitness.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “worklifebalancecourse.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “worklifebalancecourse.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “videostoprofit-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “videostoprofit-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “nathanjensencoaching.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “nathanjensencoaching.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “freepreneurstraining.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “freepreneurstraining.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “freeelectricianquote.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “freeelectricianquote.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “freepreneurs-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “freepreneurs-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “aaronwitnish-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “aaronwitnish-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “worklifeandbalance.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “worklifeandbalance.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “tattoodesignsideas.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “tattoodesignsideas.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “paulabailey-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “paulabailey-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “10kin30days-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “10kin30days-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “freebuildingquote.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “freebuildingquote.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “zahrapeermohamed.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “zahrapeermohamed.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “owningyourdreams.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “owningyourdreams.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “offlinemarketing.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “offlinemarketing.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “jamiesayedonline.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “jamiesayedonline.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “dpkaircon-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “dpkaircon-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “2014applications.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “2014applications.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “tasteactivelife.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “tasteactivelife.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “seansoolevideos.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “seansoolevideos.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “membershipsites.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “membershipsites.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “evobuilt-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “evobuilt-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “videomarketing.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “videomarketing.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “timewithnicole.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “timewithnicole.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “timewithjanice.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “timewithjanice.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “successsoldier.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “successsoldier.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “snowboardelite.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “snowboardelite.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “onlinebusiness.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “onlinebusiness.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “cpmoney-com-au.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “cpmoney-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “aaroninvesting.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “aaroninvesting.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “timewithjamie.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “timewithjamie.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “timewithaaron.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “timewithaaron.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “nicoleswanell.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “nicoleswanell.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “nichewebsites.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “nichewebsites.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “globaleconomy.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “globaleconomy.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “bondinvesting.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “bondinvesting.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “timewithzane.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “timewithzane.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “timewithjose.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “timewithjose.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “taniapoletti.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “taniapoletti.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “sharerenting.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “sharerenting.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “listbuilding.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “listbuilding.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “aaronwitnish.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “aaronwitnish.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “stockmarket.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “stockmarket.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “paidsurveys.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “paidsurveys.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “keepcurious.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “keepcurious.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “homeequity.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “homeequity.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “zanetully.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “zanetully.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “joinpbazz.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “joinpbazz.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “janicekuz.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “janicekuz.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “clickbank.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “clickbank.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “cellphone.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “cellphone.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “budgeting.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “budgeting.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “josevila.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “josevila.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “blogging.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “blogging.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “attorney.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “attorney.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “members.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “members.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “finance.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “finance.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “stocks.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “stocks.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “metals.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “metals.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “pbazz.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “pbazz.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “forex.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “forex.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “ebay.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “ebay.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Restoring userdata for “blog.passiveincomeedge.com” … [821296][RESTORE:1 ][A:inter210 ]: The system did not find a userdata file for “blog.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: userdata [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 54% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: DigestShadow [821296][RESTORE:1 ][A:inter210 ]: DigestShadow [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 55% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: SpamAssassin [821296][RESTORE:1 ][A:inter210 ]: SpamAssassin [821296][RESTORE:1 ][A:inter210 ]: Ran SpamAssassin check [821296][RESTORE:1 ][A:inter210 ]: Progress: 57% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: Postgres [821296][RESTORE:1 ][A:inter210 ]: Preparing PostgreSQL restore … [821296][RESTORE:1 ][A:inter210 ]: This archive contains no PostgreSQL data. [821296][RESTORE:1 ][A:inter210 ]: Postgres [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 60% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: Ftp [821296][RESTORE:1 ][A:inter210 ]: Ftp [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 61% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: Logs [821296][RESTORE:1 ][A:inter210 ]: Logs [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 62% (2019-11-14 23:13:30 -0700) [821296][RESTORE:1 ][A:inter210 ]: SSL [821296][RESTORE:1 ][A:inter210 ]: Migrating pre-SSLStorage home directory resources… [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/timewithaaron_com_ce88b_c372d_1564424606_5fe84c5e35316653d607a8b0fa54a08c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “2014applications.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/aaronwitnish_com_bb8b0_02289_1569771833_abc29cf9a14e4582bf1dc97cff9eec66.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “aaronwitnish.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/doneforyoubusinesses_com_au_passiveincomeedge_com_d0c58_69b39_1575082088_dff98bcbefd31ad090d595630cbfa9ea.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “doneforyoubusinesses-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/jkwitnishcarpentry_com_au_b21f3_5ef11_1580388159_cd8da7fb9e4f8e379bd1cbd8c5fd32bc.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “worklifebalancecourse.passiveincomeedge.com” 1572615759.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/keepcurious_passiveincomeedge_com_d23cd_4e4d1_1564424600_e20ccf5944a17f87a87a8a510fccf7cd.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “clickbank.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/mail_dpkaircon_com_au_e75ed_9491f_1564582856_d41c94eb0339490a38665fc5e5813582.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1556810457.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_a1b70_5e317_1574509893_9a9d0f5bf19e059f78bc26a6ddfa0fa5.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultation-com-au.passiveincomeedge.com” 1566737494.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/pbazz_passiveincomeedge_com_9bc41_c11fd_1569771845_d45a11cbdeee0c0fbc5599cb9a2fcb08.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “paidsurveys.passiveincomeedge.com” 1561999446.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freepreneurstraining_com_d5597_14e53_1564498117_10c51aaf98bae1fd883c7c8858cb8cc2.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freepreneurstraining.passiveincomeedge.com” 1556725718.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/tattoodesignsideas_passiveincomeedge_com_d973b_be685_1575117956_6a86f69884a31cd1be623218d6253115.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “tattoodesignsideas.passiveincomeedge.com” 1567345556.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/doneforyoubusinesses_com_au_adaad_0daa5_1572609628_eb35a1d78be67b043954a7fefd8380e0.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “doneforyoubusinesses-com-au.passiveincomeedge.com” 1564837228.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dpkaircon_com_au_e1794_02273_1580471129_9a0f63887a9eb1e6be3d7f3546a9985e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1572698729.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ebay_passiveincomeedge_com_e2f6a_fab79_1569771837_3adccf5460c2bee4b643747d1954f8d0.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “nichewebsites.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_e6c2b_66a11_1569161778_48f777f74daef563720e230654b454b4.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultation-com-au.passiveincomeedge.com” 1561389379.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_aeb4d_0a401_1563892535_4ceedcd24c55841d8ecd85ad5f4d7c6a.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultationjusthost.passiveincomeedge.com” 1556120136.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/williamsplumbinganddrainage_com_au_passiveincomeedge_com_c5957_35781_1581129706_8af11fa9f8ae8cc9bfccd817edf10df8.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “williamsplumbinganddrainage-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dpkaircon_com_au_b587a_a6ed1_1569931539_61c47cbce44e88e5b6c8a58a945b4b9d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1562159139.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_c4644_3c23b_1569586112_07e6c976d64fc77b45e233286a72aa1e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com” 1561813713.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_d46b0_94625_1580125349_5c21b84c8579c0d725d31e5b0baa1235.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com” 1572352950.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/doneforyoubusinesses_com_au_cd12a_d7e31_1577879308_2c539ffd47736045dde9ca0b820d2b64.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “doneforyoubusinesses-com-au.passiveincomeedge.com” 1570106910.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/theglobaldigitalmarketingagency_com_c51bd_9adb3_1576238251_ee13bf1173b0ed5a948e3560f91fe0fc.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “5stardigitalmarketingagency-com-au.passiveincomeedge.com” 1568465852.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/louvresandprivacyscreens_com_ad605_69bdb_1577274691_8a2f35d08852e9605678cf7f1a60c55d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “louvresandprivacyscreens.passiveincomeedge.com” 1569502292.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/theglobaldigitalmarketingagency_passiveincomeedge_com_9df08_25bd5_1589435790_46bc422e72fc7301928988b52c2edbc8.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “theglobaldigitalmarketingagency.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freeelectricianquote_passiveincomeedge_com_c01fc_742e3_1567579743_93ead14ad9dfe79d0f8ec7489c52766d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/theglobaldigitalmarketingagency_com_c06be_0035d_1565672685_7b19e580328e1a000e8650e6b76921d2.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “theglobaldigitalmarketingagency.passiveincomeedge.com” 1557900286.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/streetsmartbusiness_net_e0049_644dd_1580388163_7fc3ff2c61da450683c9082b2fa2fafe.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “aaronwitnish.passiveincomeedge.com” 1572615763.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/flowdigitalmarketing_com_au_b52b3_74ccb_1576670201_9ee8ee17d1112fba1b3cb113e83a3e95.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “flowdigitalmarketing-com-au.passiveincomeedge.com” 1568897803.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/quotesfortradies_com_au_d278f_33afd_1573559968_0d7ed1f5c02cd838c83b798675583c2f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “quotesfortradies-com-au.passiveincomeedge.com” 1565787569.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/electricianquote_online_d0822_53be1_1564928960_502d12ad80e06f9fd4557f9104f0370e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com” 1557156561.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_passiveincomeedge_com_a34c4_e07d7_1582677046_d3e95c4f84ff0ff00daf32d138bf6364.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/electricianquote_online_passiveincomeedge_com_eaa04_bc331_1577792908_fb255c87cfcba9b8c89e63cd93145482.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “electricianquote-online.passiveincomeedge.com” 1570020508.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/williamsplumbinganddrainage_com_au_b2ed2_1fb01_1567951534_85d4779227ee12c17ebaf48426341c4d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “williamsplumbinganddrainage-com-au.passiveincomeedge.com” 1560179136.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dpkaircon_com_au_passiveincomeedge_com_b633d_5b58d_1588303055_ff6ef8a82b3207f9b988d7eb2b947c2e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/shauneveringtonfitness_com_daecd_32db1_1564424588_15876f0187fcf28f40d8c95d7b6985fb.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “nathanjensencoaching.passiveincomeedge.com” 1556652189.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/theglobaldigitalmarketingagency_com_d386c_3d37f_1581512442_dd5943688acaaf1ae43e0b11efca000c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “5stardigitalmarketingagency-com-au.passiveincomeedge.com” 1573740043.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/quotesfortradies_com_au_b9bed_67b7b_1568210866_9cd19352c7dd92273655e4666a60a582.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “quotesfortradies-com-au.passiveincomeedge.com” 1560438467.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/shauneveringtonfitness_com_cbdf9_1612b_1575117948_bb06db3bf43580a976243ea59a3bd17c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ebay.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/seansoolevideos_passiveincomeedge_com_c9870_e66eb_1582867206_b1f6059cfc20477766027a53129d75e9.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “seansoolevideos.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/janicekuz_com_e432e_00559_1575117951_dd094046683938372b61f49d5c7163e4.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “thefastestpathtocash-net.passiveincomeedge.com” 1567345551.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/nathanjensencoaching_com_c264b_f521b_1580388155_fb480f9966f1359457a53f3e2f900b81.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “paulabailey-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/jkwitnishcarpentry_com_au_c7a6f_d0c45_1575117941_48e42fdf8234972696089d0c0aadb4ca.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “videostoprofit-com-au.passiveincomeedge.com” 1567345542.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/paidsurveys_passiveincomeedge_com_eaa6d_be7fb_1580388157_8e0e5dfaa71416cf1d969a7e9073c2e6.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “timewithjose.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/williamsplumbinganddrainage_com_au_d8702_f3e67_1573300634_57adba21e8bc844549e212c9b84d3ce5.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “williamsplumbinganddrainage-com-au.passiveincomeedge.com” 1565528238.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_ab82b_bccdd_1575806486_1f28bcdbfa7e1d432273473a984a7b4b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com” 1568034088.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebuildingquote_com_c021f_83539_1569248316_b52586bb9885b59faaf921b3ea54bf4c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebuildingquote.passiveincomeedge.com” 1561475916.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freepreneurs_com_au_passiveincomeedge_com_d509f_e6839_1566655858_c78b82a86d647fdc68466fb39c26373f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freepreneurs-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/janicekuz_com_eb04f_15753_1569771841_2ffd479dac7a158326b37e189768aa08.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “thefastestpathtocash-net.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_a97bd_988b9_1565188540_afdd223170ab8b97db243c46343e50ed.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com” 1557416141.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/zanetully_com_aead7_1cdc9_1575117938_b21227a66e2598c1a26afb198761e97b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “onlinebusiness.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/doneforyoubusinesses_com_au_da249_c4c99_1567261383_2fdcf883608766b1ced379ac18182793.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “doneforyoubusinesses-com-au.passiveincomeedge.com” 1559488985.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebuildingquote_com_d5150_db811_1563978764_f8512a59e0f251ce0f87af2a38a4e67f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebuildingquote.passiveincomeedge.com” 1556206365.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/flowdigitalmarketing_com_au_eb7ae_a39a1_1566051575_4de5572df9e84ffe9cd79bc5c7d115e4.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “flowdigitalmarketing-com-au.passiveincomeedge.com” 1558279176.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/jkwitnishcarpentry_com_au_b7eda_b2327_1564424596_a67ce0388b95ffdd29fac48f10b05e9d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “worklifebalancecourse.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/5stardigitalmarketingagency_com_au_passiveincomeedge_com_d20ad_0cd07_1589434806_f3b639ae3c78245b77a68297b3813ed0.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “5stardigitalmarketingagency-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/janicekuz_com_abe71_456b3_1580388153_5c60eb0e4fe7a10d7e58f80379021af5.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “worklifeandbalance.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freeelectricianquote_passiveincomeedge_com_bb8f3_d0439_1575547360_c958382077a8e5725bd355795bbeed4c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com” 1567774961.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_c86ea_059c3_1564237779_c6db3ca8bc562cf152eb07e9216b4a8b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com” 1556465383.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/quotesfortradies_com_au_passiveincomeedge_com_a2ea9_18e1b_1565569256_c6b948364036b98e6930a55ef9ff3b72.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “quotesfortradies-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/louvresandprivacyscreens_passiveincomeedge_com_a7851_8ffb1_1585113775_b4889f582d9cc153a1d72ba4912e41a8.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “louvresandprivacyscreens.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_au_passiveincomeedge_com_b626f_78a3d_1579779807_397b3c1a7e6428349a5063ecd7426a1b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultation-com-au.passiveincomeedge.com” 1572007408.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dgdigitalmarketing_com_au_passiveincomeedge_com_ca0a4_74981_1603737116_090f3d9ff8210f6533fdb887da4c8d29.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dgdigitalmarketing-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/5stardigitalmarketingagency_com_au_ea425_e8b0f_1565671703_1cc99945f86d91b55d121f545f713f8c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “5stardigitalmarketingagency-com-au.passiveincomeedge.com” 1557899304.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/streetsmartbusiness_net_d704b_190c5_1575117943_279f15f14d9f43fbed7d7556bea0e206.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “thedigitalmarketingagency-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebuildingquote_com_9e6bd_d572d_1574596650_02166fe2e5a7cefd4332a0ce73f81387.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebuildingquote.passiveincomeedge.com” 1566824251.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/mail_dpkaircon_com_au_b0a24_2b90d_1564540060_27e99c2087529ada7f2e57d114e9314d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1556767661.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dgdigitalmarketing_com_au_c5998_27239_1579973791_a2e57a6bc9717f8ee75ad618a6ad9d17.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dgdigitalmarketing-com-au.passiveincomeedge.com” 1572201391.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/timewithaaron_com_a85e9_3fff9_1575117946_0d211af2cb320b55138ad2dba56fa116.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “aaronwitnish.passiveincomeedge.com” 1567345547.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/williamsplumbinganddrainage_com_au_d73aa_cea53_1578570151_4091504671bf0d6c9b0ac9f9800916f0.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “williamsplumbinganddrainage-com-au.passiveincomeedge.com” 1570797751.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/flowdigitalmarketing_com_au_e1787_b285d_1571400448_2272c1f147985019f58e85da048de35b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “flowdigitalmarketing-com-au.passiveincomeedge.com” 1563628048.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/blog_passiveincomeedge_com_c8b70_a27d5_1580388151_f9471b0ce2429d009fc663445d871326.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “the-transformers-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebuildingquote_passiveincomeedge_com_c40bf_77df7_1566610432_081961889f16b595093e9317e00138ff.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebuildingquote.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freeelectricianquote_passiveincomeedge_com_d1604_5da4b_1580820389_2aa3e1b84ce5f6be3740571bee9e4e7b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com” 1573047990.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_b3c7d_77af1_1570536404_e4f8b64b0b0e62878b9705ed71ceddde.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com” 1562764006.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/paulabailey_com_au_bc91a_9c55d_1575117953_32c97e963fa7bbe62cdd83daf9ff467d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “nathanjensencoaching.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/janicekuz_com_baaa0_a3083_1564424580_a6df609a9d803fe88e3ecc58963222cb.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “owningyourdreams.passiveincomeedge.com” 1556652181.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/forex_passiveincomeedge_com_c8a5c_6b725_1564424584_2baca08f7a0bef38e9a66a7247b11f6e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “cellphone.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/flowdigitalmarketing_com_au_passiveincomeedge_com_b1404_9fdf9_1579231122_da16cb372a412a2dac73a13e04e62766.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “flowdigitalmarketing-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/electricianquote_online_f048f_c4801_1570277310_d66759435dcb8d038199d982e1190d97.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com” 1562504912.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_passiveincomeedge_com_dfc42_b2d7b_1578352011_969b7e89bfb078f72c95f6aae0b0a94f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/electricianquote_online_passiveincomeedge_com_ce061_7ecf1_1567591995_fbbb510709d2e4041a39be0008ee7481.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “electricianquote-online.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/pbazz_passiveincomeedge_com_cf723_012b9_1564424591_6bfabfb7e53248f61ff8cba5ed8d59b9.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “metals.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/nathanjensencoaching_com_c7e9f_07f13_1569771849_eb4033ec2e49f73bec5f4505cc0586cf.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “tattoodesignsideas.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/jkwitnishcarpentry_com_au_e4890_dde6f_1569771822_f1b3e2c45b831777bccb39f17fb02231.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “zanetully.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dpkaircon_com_au_a4914_00291_1575201150_fad221478b3f053d55b8f8e72e520cd3.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1567428751.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/5stardigitalmarketingagency_com_au_9f434_26683_1570968034_aea4e72de0aa16843b88fc7e5ffbb9c5.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “theglobaldigitalmarketingagency.passiveincomeedge.com” 1563195634.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultationjusthost_passiveincomeedge_com_a13a7_f84f5_1566436781_a7082a607480c270c4f87b436135a64f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultationjusthost.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/tasteactivelife_com_e25ba_7e087_1569771825_a6d873373fa668a265354556ed57b0fd.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “budgeting.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freepreneurstraining_com_bb402_b9e5f_1580388161_07f12fca1ab3c975b3a5621f71fffe70.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “budgeting.passiveincomeedge.com” 1572615761.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/timewithaaron_com_c482e_bae81_1569771830_e8106b9efb245905d599a714c5d39236.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “globaleconomy.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_967e8_0270f_1574855730_04143af4651eadda6e3058567988a66f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com” 1567083331.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/louvresandprivacyscreens_com_97ee1_77d57_1572004950_5fbe8881648bd0b4488ee87956bad7fb.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “louvresandprivacyscreens.passiveincomeedge.com” 1564232551.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_9b085_263b3_1581080230_57eb5f2a4a0a82aa7e42fd105eb6d041.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com” 1573307830.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/quotesfortradies_com_au_bdfe0_a7e99_1578829649_e11233131ce8fb3c01ee8c266ecfea48.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “quotesfortradies-com-au.passiveincomeedge.com” 1571057249.0”. [821296][RESTORE:1 ][A:inter210 ]: An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_au_passiveincomeedge_com_b3a5b_d5ba7_1566434512_f61cb16f3e5ea8ffcbed24c3a66c099c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultation-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: SSL [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 63% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: FileProtect [821296][RESTORE:1 ][A:inter210 ]: FileProtect [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 65% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Subaccount [821296][RESTORE:1 ][A:inter210 ]: Subaccount [821296][RESTORE:1 ][A:inter210 ]: Ran Subaccount database checks [821296][RESTORE:1 ][A:inter210 ]: Progress: 66% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Htaccess [821296][RESTORE:1 ][A:inter210 ]: Htaccess [821296][RESTORE:1 ][A:inter210 ]: No need to update htaccess files. [821296][RESTORE:1 ][A:inter210 ]: WebDiskHomedir [821296][RESTORE:1 ][A:inter210 ]: WebDiskHomedir [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 68% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: MailLimits [821296][RESTORE:1 ][A:inter210 ]: Restoring mail limits (if any) [821296][RESTORE:1 ][A:inter210 ]: MailLimits [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 69% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Password [821296][RESTORE:1 ][A:inter210 ]: Password [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 70% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Tomcat [821296][RESTORE:1 ][A:inter210 ]: Tomcat [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 71% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Cron [821296][RESTORE:1 ][A:inter210 ]: Restoring crontab [821296][RESTORE:1 ][A:inter210 ]: Cron [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 72% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Vhosts [821296][RESTORE:1 ][A:inter210 ]: Refreshing vhosts and restarting apache [821296][RESTORE:1 ][A:inter210 ]: Vhosts [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 74% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: ZoneFile [821296][RESTORE:1 ][A:inter210 ]: Restoring DNS zones [821296][RESTORE:1 ][A:inter210 ]: Fetching existing zones. [821296][RESTORE:1 ][A:inter210 ]: ZoneFile [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: SPF [821296][RESTORE:1 ][A:inter210 ]: Updating SPF Records [821296][RESTORE:1 ][A:inter210 ]: SPF [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 76% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: MailRouting [821296][RESTORE:1 ][A:inter210 ]: Update mail routing [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for passiveincomeedge.com's mail.This configuration has been manually selected. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for aaronwitnish.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for aaronwitnish.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for nicoleswanell.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for keepcurious.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: REMOTE MAIL EXCHANGER: This server will NOT serve as a mail exchanger for evobuilt.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for globaleconomy.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for timewithnicole.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for theglobaldigitalmarketingagency.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for clickbank.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for 5stardigitalmarketingagency-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for williamsplumbinganddrainage-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freepreneurs.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for zanetully.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for stocks.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for williamsplumbinganddrainage.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freebrokerconsultation.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for budgeting.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for blogging.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freepreneurstraining.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for tasteactivelife.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for quotesfortradies.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for streetsmartbusiness.net's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for timewithjamie.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for jkwitnishcarpentry-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for finance.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for quotesfortradies-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for dpkaircon.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for tattoodesignsideas.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for jkwitnishcarpentry.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for stockmarket.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for ubctradeservicesquote-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for theglobaldigitalmarketingagency.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for joinpbazz.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for josevila.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for timewithzane.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for worklifeandbalance.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for seansoolevideos.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for bondinvesting.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for homeequity.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for ubctradeservicesquote.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for janicekuz.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for cellphone.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for membershipsites.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for jamiesayedonline.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for blog.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for dgdigitalmarketing.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for timewithjanice.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for listbuilding.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for timewithaaron.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for videomarketing.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for forex.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freepreneurstraining.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for members.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for streetsmartbusiness-net.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for timewithaaron.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for attorney.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for dpkaircon-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for thedigitalmarketingagency-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for thedigitalmarketingagency.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for 2014applications.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freepreneurs-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for sixfigurecoaching-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for electricianquote-online.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for snowboardelite.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for videostoprofit-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for electricianquote.online's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for 5stardigitalmarketingagency.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for sixfigurecoaching.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freebrokerconsultationjusthost.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for 10kin30days-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for metals.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: REMOTE MAIL EXCHANGER: This server will NOT serve as a mail exchanger for paulabailey.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for aaronwitnish.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for offlinemarketing.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for tasteactivelife.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for onlinebusiness.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for zahrapeermohamed.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for worklifebalancecourse.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for zanetully.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for nathanjensencoaching.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for timewithjose.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for dgdigitalmarketing-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freebuildingquote.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for seansoolevideos.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for paidsurveys.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freebrokerconsultation.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for nathanjensencoaching.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for aaronwitnish-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for doneforyoubusinesses.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freeelectricianquote.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for paulabailey-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for cpmoney-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for pbazz.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for aaroninvesting.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for sharerenting.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for taniapoletti.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freeelectricianquote.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for thefastestpathtocash-net.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for janicekuz.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for flowdigitalmarketing.com.au's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for louvresandprivacyscreens.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for successsoldier.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for josevila.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for owningyourdreams.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for doneforyoubusinesses-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for ebay.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freebuildingquote.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for flowdigitalmarketing-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for the-transformers-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for evobuilt-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for nichewebsites.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for shauneveringtonfitness.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for shauneveringtonfitness.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for louvresandprivacyscreens.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: LOCAL MAIL EXCHANGER: This server will serve as a primary mail exchanger for freebrokerconsultation-com-au.passiveincomeedge.com's mail.This configuration has been automatically detected based on your mx entries. [821296][RESTORE:1 ][A:inter210 ]: MailRouting [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 77% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: ProxySubdomains [821296][RESTORE:1 ][A:inter210 ]: Update service subdomains for “inter210”. [821296][RESTORE:1 ][A:inter210 ]: 10kin30days-com-au.passiveincomeed…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: 2014applications.passiveincomeedge…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: 5stardigitalmarketingagency-com-au…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: 5stardigitalmarketingagency.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: aaroninvesting.passiveincomeedge.c…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: aaronwitnish-com-au.passiveincomee…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: aaronwitnish.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: aaronwitnish.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: aaronwitnish.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: attorney.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: blog.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: blogging.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: bondinvesting.passiveincomeedge.com[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: budgeting.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: cellphone.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: clickbank.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: cpmoney-com-au.passiveincomeedge.c…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: dgdigitalmarketing-com-au.passivei…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: dgdigitalmarketing.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: doneforyoubusinesses-com-au.passiv…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: doneforyoubusinesses.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: dpkaircon-com-au.passiveincomeedge…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: dpkaircon.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: ebay.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: electricianquote-online.passiveinc…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: electricianquote.online [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: evobuilt-com-au.passiveincomeedge.…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: evobuilt.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: finance.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: flowdigitalmarketing-com-au.passiv…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: flowdigitalmarketing.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: forex.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freebrokerconsultation-com-au.pass…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freebrokerconsultation.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freebrokerconsultation.com.au [FAIL:The “A” record for “webmail.freebrokerconsultation.com.au.” could not be added because it would conflict with the existing “CNAME” record., The “A” record for “cpanel.freebrokerconsultation.com.au.” could not be added because it would conflict with the existing “CNAME” record.] [821296][RESTORE:1 ][A:inter210 ]: freebrokerconsultationjusthost.pas…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freebuildingquote.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freebuildingquote.passiveincomeedg…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freeelectricianquote.com [FAIL:The “A” record for “webmail.freeelectricianquote.com.” could not be added because it would conflict with the existing “CNAME” record., The “A” record for “cpanel.freeelectricianquote.com.” could not be added because it would conflict with the existing “CNAME” record.] [821296][RESTORE:1 ][A:inter210 ]: freeelectricianquote.passiveincome…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freepreneurs-com-au.passiveincomee…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freepreneurs.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freepreneurstraining.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: freepreneurstraining.passiveincome…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: globaleconomy.passiveincomeedge.com[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: homeequity.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: jamiesayedonline.passiveincomeedge…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: janicekuz.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: janicekuz.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: jkwitnishcarpentry-com-au.passivei…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: jkwitnishcarpentry.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: joinpbazz.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: josevila.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: josevila.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: keepcurious.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: listbuilding.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: louvresandprivacyscreens.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: louvresandprivacyscreens.passivein…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: members.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: membershipsites.passiveincomeedge.…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: metals.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: nathanjensencoaching.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: nathanjensencoaching.passiveincome…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: nichewebsites.passiveincomeedge.com[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: nicoleswanell.passiveincomeedge.com[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: offlinemarketing.passiveincomeedge…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: onlinebusiness.passiveincomeedge.c…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: owningyourdreams.passiveincomeedge…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: paidsurveys.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: paulabailey-com-au.passiveincomeed…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: paulabailey.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: pbazz.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: quotesfortradies-com-au.passiveinc…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: quotesfortradies.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: seansoolevideos.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: seansoolevideos.passiveincomeedge.…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: sharerenting.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: shauneveringtonfitness.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: shauneveringtonfitness.passiveinco…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: sixfigurecoaching-com-au.passivein…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: sixfigurecoaching.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: snowboardelite.passiveincomeedge.c…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: stockmarket.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: stocks.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: streetsmartbusiness-net.passiveinc…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: streetsmartbusiness.net [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: successsoldier.passiveincomeedge.c…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: taniapoletti.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: tasteactivelife.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: tasteactivelife.passiveincomeedge.…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: tattoodesignsideas.passiveincomeed…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: the-transformers-com-au.passiveinc…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: thedigitalmarketingagency-com-au.p…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: thedigitalmarketingagency.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: thefastestpathtocash-net.passivein…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: theglobaldigitalmarketingagency.com[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: theglobaldigitalmarketingagency.pa…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: timewithaaron.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: timewithaaron.passiveincomeedge.com[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: timewithjamie.passiveincomeedge.com[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: timewithjanice.passiveincomeedge.c…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: timewithjose.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: timewithnicole.passiveincomeedge.c…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: timewithzane.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: ubctradeservicesquote-com-au.passi…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: ubctradeservicesquote.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: videomarketing.passiveincomeedge.c…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: videostoprofit-com-au.passiveincom…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: williamsplumbinganddrainage-com-au…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: williamsplumbinganddrainage.com.au [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: worklifeandbalance.passiveincomeed…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: worklifebalancecourse.passiveincom…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: zahrapeermohamed.passiveincomeedge…[no changes needed] [821296][RESTORE:1 ][A:inter210 ]: zanetully.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: zanetully.passiveincomeedge.com [no changes needed] [821296][RESTORE:1 ][A:inter210 ]: ProxySubdomains [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 78% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: PublishZones [821296][RESTORE:1 ][A:inter210 ]: Reloading zones [821296][RESTORE:1 ][A:inter210 ]: PublishZones [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 79% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: PostRestoreActions [821296][RESTORE:1 ][A:inter210 ]: Updating Caches … [821296][RESTORE:1 ][A:inter210 ]: Enabling IPv6 for account … [821296][RESTORE:1 ][A:inter210 ]: Updating Nameserver IP Address Report [821296][RESTORE:1 ][A:inter210 ]: Syncing contact information [821296][RESTORE:1 ][A:inter210 ]: Running postrestore script [821296][RESTORE:1 ]: Account “inter210”: Warning (181 warnings and 2 skipped items) [821296][RESTORE:1 ]: Progress: 100% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ]: Child Complete [821296][RESTORE:1 ][A:inter210 ]: PostRestoreActions [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 80% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Quota [821296][RESTORE:1 ][A:inter210 ]: Quota [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 82% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: MysqlRemoteNotes [821296][RESTORE:1 ][A:inter210 ]: MysqlRemoteNotes [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: APITokens [821296][RESTORE:1 ][A:inter210 ]: APITokens [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 83% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: AuthnLinks [821296][RESTORE:1 ][A:inter210 ]: AuthnLinks [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 85% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: BandwidthData [821296][RESTORE:1 ][A:inter210 ]: Restoring Bandwidth Data [821296][RESTORE:1 ][A:inter210 ]: Importing legacy RRD data … [821296][RESTORE:1 ][A:inter210 ]: BandwidthData [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 88% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Suspend [821296][RESTORE:1 ][A:inter210 ]: The user “inter210” was not suspended. The system will not suspend the restored user. [821296][RESTORE:1 ][A:inter210 ]: Suspend [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Progress: 90% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Progress: 100% (2019-11-14 23:13:31 -0700) [821296][RESTORE:1 ][A:inter210 ]: Success. [821296][RESTORE:1 ][A:inter210 ]: Warning (“Homedir::restricted_restore”, line 119): This account archive contains no home directory files to restore. [821296][RESTORE:1 ][A:inter210 ]: Warning (“Domains::restricted_restore”, line 119): Failed to open(/var/migration_dir/cpanelpkgrestore.TMP.work.7b3275da/safe_to_read_archive/contents/pds): No such file or directory [821296][RESTORE:1 ][A:inter210 ]: Warning (“Domains::restricted_restore”, line 119): Failed to open(/var/migration_dir/cpanelpkgrestore.TMP.work.7b3275da/safe_to_read_archive/contents/addons): No such file or directory [821296][RESTORE:1 ][A:inter210 ]: Warning (“Horde::restricted_restore”, line 119): : Running database checks for 1 account(s) … [821296][RESTORE:1 ][A:inter210 ]: Starting update of 1 user in parallel … [821296][RESTORE:1 ][A:inter210 ]: ------------------------------------------------------------------------ [821296][RESTORE:1 ][A:inter210 ]: Summary: [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: Ran database checks on 1 account(s). [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: There were 0 accounts with failures during this process (see above): [821296][RESTORE:1 ][A:inter210 ]: n/a [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: There were 1 accounts successfully processed: [821296][RESTORE:1 ][A:inter210 ]: inter210 [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: There were 0 accounts that did not need any work done: [821296][RESTORE:1 ][A:inter210 ]: n/a [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: [821296][RESTORE:1 ][A:inter210 ]: [2019-11-14 23:13:28 -0700] info [update_horde_config] Quota file /home1/inter210/etc/theglobaldigitalmarketingagency.com/quota does not exist; skipping [821296][RESTORE:1 ][A:inter210 ]: [2019-11-14 23:13:28 -0700] info [update_horde_config] Quota file /home1/inter210/etc/dgdigitalmarketing.com.au/quota does not exist; skipping [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “williamsplumbinganddrainage-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “5stardigitalmarketingagency-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “thedigitalmarketingagency-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “theglobaldigitalmarketingagency.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “freebrokerconsultationjusthost.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “freebrokerconsultation-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “ubctradeservicesquote-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “flowdigitalmarketing-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “doneforyoubusinesses-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “jkwitnishcarpentry-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “dgdigitalmarketing-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “thefastestpathtocash-net.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “sixfigurecoaching-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “louvresandprivacyscreens.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “the-transformers-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “streetsmartbusiness-net.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “quotesfortradies-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “electricianquote-online.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “shauneveringtonfitness.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “worklifebalancecourse.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “videostoprofit-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “nathanjensencoaching.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “freepreneurstraining.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “freeelectricianquote.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “freepreneurs-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “aaronwitnish-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “worklifeandbalance.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “tattoodesignsideas.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “paulabailey-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “10kin30days-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “freebuildingquote.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “zahrapeermohamed.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “owningyourdreams.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “offlinemarketing.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “jamiesayedonline.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “dpkaircon-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “2014applications.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “tasteactivelife.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “seansoolevideos.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “membershipsites.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “evobuilt-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “videomarketing.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “timewithnicole.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “timewithjanice.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “successsoldier.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “snowboardelite.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “onlinebusiness.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “cpmoney-com-au.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “aaroninvesting.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “timewithjamie.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “timewithaaron.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “nicoleswanell.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “nichewebsites.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “globaleconomy.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “bondinvesting.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “timewithzane.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “timewithjose.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “taniapoletti.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “sharerenting.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “listbuilding.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “aaronwitnish.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “stockmarket.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “paidsurveys.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “keepcurious.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “homeequity.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “zanetully.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “joinpbazz.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “janicekuz.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “clickbank.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “cellphone.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “budgeting.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “josevila.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “blogging.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “attorney.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “members.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “finance.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “stocks.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “metals.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “pbazz.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “forex.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “ebay.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“userdata::_restore_for_each_vhost”, line 128): The system did not find a userdata file for “blog.passiveincomeedge.com” in the archive. The archive may be incomplete or you may be transferring from a non-cPanel & WHM system. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/timewithaaron_com_ce88b_c372d_1564424606_5fe84c5e35316653d607a8b0fa54a08c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “2014applications.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/aaronwitnish_com_bb8b0_02289_1569771833_abc29cf9a14e4582bf1dc97cff9eec66.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “aaronwitnish.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/doneforyoubusinesses_com_au_passiveincomeedge_com_d0c58_69b39_1575082088_dff98bcbefd31ad090d595630cbfa9ea.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “doneforyoubusinesses-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/jkwitnishcarpentry_com_au_b21f3_5ef11_1580388159_cd8da7fb9e4f8e379bd1cbd8c5fd32bc.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “worklifebalancecourse.passiveincomeedge.com” 1572615759.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/keepcurious_passiveincomeedge_com_d23cd_4e4d1_1564424600_e20ccf5944a17f87a87a8a510fccf7cd.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “clickbank.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/mail_dpkaircon_com_au_e75ed_9491f_1564582856_d41c94eb0339490a38665fc5e5813582.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1556810457.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_a1b70_5e317_1574509893_9a9d0f5bf19e059f78bc26a6ddfa0fa5.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultation-com-au.passiveincomeedge.com” 1566737494.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/pbazz_passiveincomeedge_com_9bc41_c11fd_1569771845_d45a11cbdeee0c0fbc5599cb9a2fcb08.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “paidsurveys.passiveincomeedge.com” 1561999446.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freepreneurstraining_com_d5597_14e53_1564498117_10c51aaf98bae1fd883c7c8858cb8cc2.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freepreneurstraining.passiveincomeedge.com” 1556725718.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/tattoodesignsideas_passiveincomeedge_com_d973b_be685_1575117956_6a86f69884a31cd1be623218d6253115.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “tattoodesignsideas.passiveincomeedge.com” 1567345556.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/doneforyoubusinesses_com_au_adaad_0daa5_1572609628_eb35a1d78be67b043954a7fefd8380e0.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “doneforyoubusinesses-com-au.passiveincomeedge.com” 1564837228.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dpkaircon_com_au_e1794_02273_1580471129_9a0f63887a9eb1e6be3d7f3546a9985e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1572698729.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ebay_passiveincomeedge_com_e2f6a_fab79_1569771837_3adccf5460c2bee4b643747d1954f8d0.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “nichewebsites.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_e6c2b_66a11_1569161778_48f777f74daef563720e230654b454b4.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultation-com-au.passiveincomeedge.com” 1561389379.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_aeb4d_0a401_1563892535_4ceedcd24c55841d8ecd85ad5f4d7c6a.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultationjusthost.passiveincomeedge.com” 1556120136.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/williamsplumbinganddrainage_com_au_passiveincomeedge_com_c5957_35781_1581129706_8af11fa9f8ae8cc9bfccd817edf10df8.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “williamsplumbinganddrainage-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dpkaircon_com_au_b587a_a6ed1_1569931539_61c47cbce44e88e5b6c8a58a945b4b9d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1562159139.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_c4644_3c23b_1569586112_07e6c976d64fc77b45e233286a72aa1e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com” 1561813713.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_d46b0_94625_1580125349_5c21b84c8579c0d725d31e5b0baa1235.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com” 1572352950.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/doneforyoubusinesses_com_au_cd12a_d7e31_1577879308_2c539ffd47736045dde9ca0b820d2b64.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “doneforyoubusinesses-com-au.passiveincomeedge.com” 1570106910.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/theglobaldigitalmarketingagency_com_c51bd_9adb3_1576238251_ee13bf1173b0ed5a948e3560f91fe0fc.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “5stardigitalmarketingagency-com-au.passiveincomeedge.com” 1568465852.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/louvresandprivacyscreens_com_ad605_69bdb_1577274691_8a2f35d08852e9605678cf7f1a60c55d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “louvresandprivacyscreens.passiveincomeedge.com” 1569502292.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/theglobaldigitalmarketingagency_passiveincomeedge_com_9df08_25bd5_1589435790_46bc422e72fc7301928988b52c2edbc8.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “theglobaldigitalmarketingagency.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freeelectricianquote_passiveincomeedge_com_c01fc_742e3_1567579743_93ead14ad9dfe79d0f8ec7489c52766d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/theglobaldigitalmarketingagency_com_c06be_0035d_1565672685_7b19e580328e1a000e8650e6b76921d2.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “theglobaldigitalmarketingagency.passiveincomeedge.com” 1557900286.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/streetsmartbusiness_net_e0049_644dd_1580388163_7fc3ff2c61da450683c9082b2fa2fafe.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “aaronwitnish.passiveincomeedge.com” 1572615763.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/flowdigitalmarketing_com_au_b52b3_74ccb_1576670201_9ee8ee17d1112fba1b3cb113e83a3e95.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “flowdigitalmarketing-com-au.passiveincomeedge.com” 1568897803.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/quotesfortradies_com_au_d278f_33afd_1573559968_0d7ed1f5c02cd838c83b798675583c2f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “quotesfortradies-com-au.passiveincomeedge.com” 1565787569.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/electricianquote_online_d0822_53be1_1564928960_502d12ad80e06f9fd4557f9104f0370e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com” 1557156561.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_passiveincomeedge_com_a34c4_e07d7_1582677046_d3e95c4f84ff0ff00daf32d138bf6364.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/electricianquote_online_passiveincomeedge_com_eaa04_bc331_1577792908_fb255c87cfcba9b8c89e63cd93145482.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “electricianquote-online.passiveincomeedge.com” 1570020508.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/williamsplumbinganddrainage_com_au_b2ed2_1fb01_1567951534_85d4779227ee12c17ebaf48426341c4d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “williamsplumbinganddrainage-com-au.passiveincomeedge.com” 1560179136.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dpkaircon_com_au_passiveincomeedge_com_b633d_5b58d_1588303055_ff6ef8a82b3207f9b988d7eb2b947c2e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/shauneveringtonfitness_com_daecd_32db1_1564424588_15876f0187fcf28f40d8c95d7b6985fb.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “nathanjensencoaching.passiveincomeedge.com” 1556652189.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/theglobaldigitalmarketingagency_com_d386c_3d37f_1581512442_dd5943688acaaf1ae43e0b11efca000c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “5stardigitalmarketingagency-com-au.passiveincomeedge.com” 1573740043.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/quotesfortradies_com_au_b9bed_67b7b_1568210866_9cd19352c7dd92273655e4666a60a582.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “quotesfortradies-com-au.passiveincomeedge.com” 1560438467.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/shauneveringtonfitness_com_cbdf9_1612b_1575117948_bb06db3bf43580a976243ea59a3bd17c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ebay.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/seansoolevideos_passiveincomeedge_com_c9870_e66eb_1582867206_b1f6059cfc20477766027a53129d75e9.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “seansoolevideos.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/janicekuz_com_e432e_00559_1575117951_dd094046683938372b61f49d5c7163e4.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “thefastestpathtocash-net.passiveincomeedge.com” 1567345551.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/nathanjensencoaching_com_c264b_f521b_1580388155_fb480f9966f1359457a53f3e2f900b81.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “paulabailey-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/jkwitnishcarpentry_com_au_c7a6f_d0c45_1575117941_48e42fdf8234972696089d0c0aadb4ca.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “videostoprofit-com-au.passiveincomeedge.com” 1567345542.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/paidsurveys_passiveincomeedge_com_eaa6d_be7fb_1580388157_8e0e5dfaa71416cf1d969a7e9073c2e6.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “timewithjose.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/williamsplumbinganddrainage_com_au_d8702_f3e67_1573300634_57adba21e8bc844549e212c9b84d3ce5.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “williamsplumbinganddrainage-com-au.passiveincomeedge.com” 1565528238.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_ab82b_bccdd_1575806486_1f28bcdbfa7e1d432273473a984a7b4b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com” 1568034088.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebuildingquote_com_c021f_83539_1569248316_b52586bb9885b59faaf921b3ea54bf4c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebuildingquote.passiveincomeedge.com” 1561475916.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freepreneurs_com_au_passiveincomeedge_com_d509f_e6839_1566655858_c78b82a86d647fdc68466fb39c26373f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freepreneurs-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/janicekuz_com_eb04f_15753_1569771841_2ffd479dac7a158326b37e189768aa08.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “thefastestpathtocash-net.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_a97bd_988b9_1565188540_afdd223170ab8b97db243c46343e50ed.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com” 1557416141.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/zanetully_com_aead7_1cdc9_1575117938_b21227a66e2598c1a26afb198761e97b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “onlinebusiness.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/doneforyoubusinesses_com_au_da249_c4c99_1567261383_2fdcf883608766b1ced379ac18182793.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “doneforyoubusinesses-com-au.passiveincomeedge.com” 1559488985.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebuildingquote_com_d5150_db811_1563978764_f8512a59e0f251ce0f87af2a38a4e67f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebuildingquote.passiveincomeedge.com” 1556206365.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/flowdigitalmarketing_com_au_eb7ae_a39a1_1566051575_4de5572df9e84ffe9cd79bc5c7d115e4.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “flowdigitalmarketing-com-au.passiveincomeedge.com” 1558279176.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/jkwitnishcarpentry_com_au_b7eda_b2327_1564424596_a67ce0388b95ffdd29fac48f10b05e9d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “worklifebalancecourse.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/5stardigitalmarketingagency_com_au_passiveincomeedge_com_d20ad_0cd07_1589434806_f3b639ae3c78245b77a68297b3813ed0.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “5stardigitalmarketingagency-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/janicekuz_com_abe71_456b3_1580388153_5c60eb0e4fe7a10d7e58f80379021af5.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “worklifeandbalance.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freeelectricianquote_passiveincomeedge_com_bb8f3_d0439_1575547360_c958382077a8e5725bd355795bbeed4c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com” 1567774961.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_c86ea_059c3_1564237779_c6db3ca8bc562cf152eb07e9216b4a8b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com” 1556465383.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/quotesfortradies_com_au_passiveincomeedge_com_a2ea9_18e1b_1565569256_c6b948364036b98e6930a55ef9ff3b72.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “quotesfortradies-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/louvresandprivacyscreens_passiveincomeedge_com_a7851_8ffb1_1585113775_b4889f582d9cc153a1d72ba4912e41a8.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “louvresandprivacyscreens.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_au_passiveincomeedge_com_b626f_78a3d_1579779807_397b3c1a7e6428349a5063ecd7426a1b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultation-com-au.passiveincomeedge.com” 1572007408.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dgdigitalmarketing_com_au_passiveincomeedge_com_ca0a4_74981_1603737116_090f3d9ff8210f6533fdb887da4c8d29.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dgdigitalmarketing-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/5stardigitalmarketingagency_com_au_ea425_e8b0f_1565671703_1cc99945f86d91b55d121f545f713f8c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “5stardigitalmarketingagency-com-au.passiveincomeedge.com” 1557899304.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/streetsmartbusiness_net_d704b_190c5_1575117943_279f15f14d9f43fbed7d7556bea0e206.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “thedigitalmarketingagency-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebuildingquote_com_9e6bd_d572d_1574596650_02166fe2e5a7cefd4332a0ce73f81387.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebuildingquote.passiveincomeedge.com” 1566824251.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/mail_dpkaircon_com_au_b0a24_2b90d_1564540060_27e99c2087529ada7f2e57d114e9314d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1556767661.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dgdigitalmarketing_com_au_c5998_27239_1579973791_a2e57a6bc9717f8ee75ad618a6ad9d17.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dgdigitalmarketing-com-au.passiveincomeedge.com” 1572201391.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/timewithaaron_com_a85e9_3fff9_1575117946_0d211af2cb320b55138ad2dba56fa116.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “aaronwitnish.passiveincomeedge.com” 1567345547.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/williamsplumbinganddrainage_com_au_d73aa_cea53_1578570151_4091504671bf0d6c9b0ac9f9800916f0.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “williamsplumbinganddrainage-com-au.passiveincomeedge.com” 1570797751.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/flowdigitalmarketing_com_au_e1787_b285d_1571400448_2272c1f147985019f58e85da048de35b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “flowdigitalmarketing-com-au.passiveincomeedge.com” 1563628048.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/blog_passiveincomeedge_com_c8b70_a27d5_1580388151_f9471b0ce2429d009fc663445d871326.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “the-transformers-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebuildingquote_passiveincomeedge_com_c40bf_77df7_1566610432_081961889f16b595093e9317e00138ff.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebuildingquote.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freeelectricianquote_passiveincomeedge_com_d1604_5da4b_1580820389_2aa3e1b84ce5f6be3740571bee9e4e7b.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com” 1573047990.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_b3c7d_77af1_1570536404_e4f8b64b0b0e62878b9705ed71ceddde.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com” 1562764006.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/paulabailey_com_au_bc91a_9c55d_1575117953_32c97e963fa7bbe62cdd83daf9ff467d.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “nathanjensencoaching.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/janicekuz_com_baaa0_a3083_1564424580_a6df609a9d803fe88e3ecc58963222cb.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “owningyourdreams.passiveincomeedge.com” 1556652181.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/forex_passiveincomeedge_com_c8a5c_6b725_1564424584_2baca08f7a0bef38e9a66a7247b11f6e.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “cellphone.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/flowdigitalmarketing_com_au_passiveincomeedge_com_b1404_9fdf9_1579231122_da16cb372a412a2dac73a13e04e62766.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “flowdigitalmarketing-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/electricianquote_online_f048f_c4801_1570277310_d66759435dcb8d038199d982e1190d97.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freeelectricianquote.passiveincomeedge.com” 1562504912.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_passiveincomeedge_com_dfc42_b2d7b_1578352011_969b7e89bfb078f72c95f6aae0b0a94f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/electricianquote_online_passiveincomeedge_com_ce061_7ecf1_1567591995_fbbb510709d2e4041a39be0008ee7481.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “electricianquote-online.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/pbazz_passiveincomeedge_com_cf723_012b9_1564424591_6bfabfb7e53248f61ff8cba5ed8d59b9.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “metals.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/nathanjensencoaching_com_c7e9f_07f13_1569771849_eb4033ec2e49f73bec5f4505cc0586cf.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “tattoodesignsideas.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/jkwitnishcarpentry_com_au_e4890_dde6f_1569771822_f1b3e2c45b831777bccb39f17fb02231.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “zanetully.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/dpkaircon_com_au_a4914_00291_1575201150_fad221478b3f053d55b8f8e72e520cd3.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “dpkaircon-com-au.passiveincomeedge.com” 1567428751.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/5stardigitalmarketingagency_com_au_9f434_26683_1570968034_aea4e72de0aa16843b88fc7e5ffbb9c5.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “theglobaldigitalmarketingagency.passiveincomeedge.com” 1563195634.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultationjusthost_passiveincomeedge_com_a13a7_f84f5_1566436781_a7082a607480c270c4f87b436135a64f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultationjusthost.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/tasteactivelife_com_e25ba_7e087_1569771825_a6d873373fa668a265354556ed57b0fd.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “budgeting.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freepreneurstraining_com_bb402_b9e5f_1580388161_07f12fca1ab3c975b3a5621f71fffe70.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “budgeting.passiveincomeedge.com” 1572615761.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/timewithaaron_com_c482e_bae81_1569771830_e8106b9efb245905d599a714c5d39236.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “globaleconomy.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/ubctradeservicesquote_com_au_967e8_0270f_1574855730_04143af4651eadda6e3058567988a66f.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “ubctradeservicesquote-com-au.passiveincomeedge.com” 1567083331.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/louvresandprivacyscreens_com_97ee1_77d57_1572004950_5fbe8881648bd0b4488ee87956bad7fb.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “louvresandprivacyscreens.passiveincomeedge.com” 1564232551.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/evobuilt_com_au_9b085_263b3_1581080230_57eb5f2a4a0a82aa7e42fd105eb6d041.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “evobuilt-com-au.passiveincomeedge.com” 1573307830.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/quotesfortradies_com_au_bdfe0_a7e99_1578829649_e11233131ce8fb3c01ee8c266ecfea48.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “quotesfortradies-com-au.passiveincomeedge.com” 1571057249.0”. [821296][RESTORE:1 ][A:inter210 ]: Warning (“SSL::_migrate_homedir_to_sslstorage”, line 51): An error prevented adding a record of type “crt” (/home1/inter210/ssl/certs/freebrokerconsultation_com_au_passiveincomeedge_com_b3a5b_d5ba7_1566434512_f61cb16f3e5ea8ffcbed24c3a66c099c.crt) to the SSL datastore for the user “inter210”: That certificate is already installed as “Cert for “freebrokerconsultation-com-au.passiveincomeedge.com””. [821296][RESTORE:1 ][A:inter210 ]: Skipped item (“AccountRestoration::_run_restore_system_module”, line 474): The “PreRestoreActions” restore module failed because of an error: Can't locate object method "die" via package "Whostmgr::Transfers::Utils" at /usr/local/cpanel/Whostmgr/Transfers/Systems/PreRestoreActions.pm line 84. [821296][RESTORE:1 ][A:inter210 ]: Skipped item (“Domains::restricted_restore”, line 119): Failed to find a sds2 or sds file [821295][MASTER ]: Session Complete